BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_pT_H22
(678 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.2
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.2
>AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor
protein.
Length = 587
Score = 21.4 bits (43), Expect = 8.2
Identities = 9/34 (26%), Positives = 16/34 (47%)
Frame = +1
Query: 1 FINMLFIPSFSWGACSKQH*CLAYCNWHLLWRET 102
F+ L + SF CS + + W +WR++
Sbjct: 5 FVAFLPVKSFRESRCSVRCSAASGLRWFEIWRDS 38
>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
protein.
Length = 1143
Score = 21.4 bits (43), Expect = 8.2
Identities = 7/10 (70%), Positives = 9/10 (90%)
Frame = +3
Query: 360 WYVSTMLGSR 389
WY+ST +GSR
Sbjct: 298 WYMSTEIGSR 307
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,430
Number of Sequences: 438
Number of extensions: 3646
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20586735
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -