BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_pT_H10
(463 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC006677-10|AAF39946.1| 330|Caenorhabditis elegans Serpentine r... 27 4.9
>AC006677-10|AAF39946.1| 330|Caenorhabditis elegans Serpentine
receptor, class j protein18 protein.
Length = 330
Score = 27.5 bits (58), Expect = 4.9
Identities = 15/45 (33%), Positives = 24/45 (53%)
Frame = +1
Query: 106 CALIKGHCFYLTIYFYLRFRLLKETNQINS*GVFLKYSVSVSKML 240
CA I G L I+F R+ +LK T+ ++ F+ Y + +S L
Sbjct: 96 CAFIAGTYGILNIHFIFRYNVLKNTSFVSH--YFMPYGLILSIFL 138
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,628,184
Number of Sequences: 27780
Number of extensions: 114788
Number of successful extensions: 166
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 166
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 818426686
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -