Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_pT_F02
         (483 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF043433-1|AAC05656.1|  231|Anopheles gambiae putative pupal-spe...    31   0.027
AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan transpo...    22   9.6  
AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan transpo...    22   9.6  

>AF043433-1|AAC05656.1|  231|Anopheles gambiae putative
           pupal-specific cuticular proteinprotein.
          Length = 231

 Score = 30.7 bits (66), Expect = 0.027
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = -2

Query: 281 YETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVTYVA-NEGGFQPSAPHX 105
           YE S  +  + TG +KN        EV G+++ +  DG    V Y A +  GF       
Sbjct: 84  YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRPE 143

Query: 104 PKA 96
           P A
Sbjct: 144 PSA 146


>AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 56  LFWXLCWG 79
           L+W +CWG
Sbjct: 528 LYWRICWG 535


>AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 56  LFWXLCWG 79
           L+W +CWG
Sbjct: 528 LYWRICWG 535


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 380,013
Number of Sequences: 2352
Number of extensions: 6137
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 42285900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)