BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_pT_E01
(642 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 7.7
DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 7.7
AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 7.7
>U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin
protein.
Length = 377
Score = 21.4 bits (43), Expect = 7.7
Identities = 7/12 (58%), Positives = 10/12 (83%)
Frame = -2
Query: 143 FLVCSGVWTIYF 108
+LVC G+W +YF
Sbjct: 216 YLVCYGIW-VYF 226
>DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine
receptor beta2subunit protein.
Length = 427
Score = 21.4 bits (43), Expect = 7.7
Identities = 10/44 (22%), Positives = 21/44 (47%)
Frame = -3
Query: 478 ILITGITSTCQGISRIAIEDIRIKTRAVFC*MFIRLSKVCLHNH 347
I++ +TS + ++E I + + C F + VC ++H
Sbjct: 120 IVMHSVTSVGIDLEMPSVECIVFNSGTILCVPFTTYTPVCEYDH 163
>AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength
rhodopsin protein.
Length = 154
Score = 21.4 bits (43), Expect = 7.7
Identities = 7/12 (58%), Positives = 10/12 (83%)
Frame = -2
Query: 143 FLVCSGVWTIYF 108
+LVC G+W +YF
Sbjct: 92 YLVCYGIW-VYF 102
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,370
Number of Sequences: 438
Number of extensions: 3107
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19315974
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -