SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_pT_E01
         (642 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodops...    21   7.7  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    21   7.7  
AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength rhodo...    21   7.7  

>U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodopsin
           protein.
          Length = 377

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 143 FLVCSGVWTIYF 108
           +LVC G+W +YF
Sbjct: 216 YLVCYGIW-VYF 226


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 10/44 (22%), Positives = 21/44 (47%)
 Frame = -3

Query: 478 ILITGITSTCQGISRIAIEDIRIKTRAVFC*MFIRLSKVCLHNH 347
           I++  +TS    +   ++E I   +  + C  F   + VC ++H
Sbjct: 120 IVMHSVTSVGIDLEMPSVECIVFNSGTILCVPFTTYTPVCEYDH 163


>AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength
           rhodopsin protein.
          Length = 154

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 143 FLVCSGVWTIYF 108
           +LVC G+W +YF
Sbjct: 92  YLVCYGIW-VYF 102


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,370
Number of Sequences: 438
Number of extensions: 3107
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19315974
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -