SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_pT_C05
         (456 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-2719|AAF55707.2| 1362|Drosophila melanogaster CG4562-PA...    28   6.8  

>AE014297-2719|AAF55707.2| 1362|Drosophila melanogaster CG4562-PA
            protein.
          Length = 1362

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = -3

Query: 424  FSVLTXIYVKKIHTXVVPVTGSXTFFILLKISRFVQVNMYVNCSV 290
            F +LT    K  H+ +V  TG  TF  LLK+++ V +   + C++
Sbjct: 1296 FELLTTSEKKVFHS-MVKQTGDSTFDALLKVAQKVGLRFKIQCNL 1339


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,617,114
Number of Sequences: 53049
Number of extensions: 370833
Number of successful extensions: 906
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 889
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 901
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1497419784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -