BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_pT_C05
(456 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-2719|AAF55707.2| 1362|Drosophila melanogaster CG4562-PA... 28 6.8
>AE014297-2719|AAF55707.2| 1362|Drosophila melanogaster CG4562-PA
protein.
Length = 1362
Score = 27.9 bits (59), Expect = 6.8
Identities = 15/45 (33%), Positives = 25/45 (55%)
Frame = -3
Query: 424 FSVLTXIYVKKIHTXVVPVTGSXTFFILLKISRFVQVNMYVNCSV 290
F +LT K H+ +V TG TF LLK+++ V + + C++
Sbjct: 1296 FELLTTSEKKVFHS-MVKQTGDSTFDALLKVAQKVGLRFKIQCNL 1339
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,617,114
Number of Sequences: 53049
Number of extensions: 370833
Number of successful extensions: 906
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 889
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 901
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1497419784
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -