SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_pT_B15
         (335 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s...    22   5.4  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            22   7.1  
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    22   7.1  
AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless male-spe...    22   7.1  

>AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl
           symporter protein.
          Length = 1127

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -2

Query: 220 KSFQVL*KX*TYERHLWW*KNIQKSRCPLR*A*MTF 113
           K FQ L K   Y +  W+ K   K+  P+R   +TF
Sbjct: 522 KVFQALCKDKLYPKISWFGKGFGKNNEPVRGYILTF 557


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = -3

Query: 333  NEFGRPIPQKHQDKLKKPEFNNQFELHSDATSNENNSTK 217
            ++  RPI Q    K+        FE H +   N +N+T+
Sbjct: 1720 DDIERPILQTKWTKVHPENDAKMFEFHENFILNFDNATQ 1758


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 306 KHQDKLKKPEFNN 268
           KH D+L  P+F+N
Sbjct: 573 KHADRLNAPKFSN 585


>AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless
           male-specific zinc-fingerC isoform protein.
          Length = 569

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 306 KHQDKLKKPEFNN 268
           KH D+L  P+F+N
Sbjct: 549 KHADRLNAPKFSN 561


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 271,094
Number of Sequences: 2352
Number of extensions: 5142
Number of successful extensions: 21
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 56
effective length of database: 432,267
effective search space used: 23774685
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -