BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_pT_B10
(609 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A6LC36 Cluster: Putative uncharacterized protein; n=1; ... 32 9.3
>UniRef50_A6LC36 Cluster: Putative uncharacterized protein; n=1;
Parabacteroides distasonis ATCC 8503|Rep: Putative
uncharacterized protein - Parabacteroides distasonis
(strain ATCC 8503 / DSM 20701 / NCTC11152)
Length = 80
Score = 32.3 bits (70), Expect = 9.3
Identities = 15/44 (34%), Positives = 25/44 (56%)
Frame = +1
Query: 25 NXCCYIMSIALIKISLKLFKYKVVINYQILNSESYLIFTQIYTK 156
N C+I + +I + F + +IN LN++SY ++ IYTK
Sbjct: 30 NYLCHICYVKKERI-IPFFSRRPIINITSLNNKSYSVYVNIYTK 72
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 532,380,227
Number of Sequences: 1657284
Number of extensions: 9991553
Number of successful extensions: 18798
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18281
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18798
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43562448615
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -