Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_F_O21
         (731 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY081778-1|AAL91655.1|  507|Anopheles gambiae cytochrome P450 pr...    26   1.4  
DQ004401-1|AAY21240.1|  153|Anopheles gambiae lysozyme c-7 protein.    23   7.4  
AY873992-1|AAW71999.1|  259|Anopheles gambiae nanos protein.           23   9.7  
AY583530-1|AAS93544.1|  260|Anopheles gambiae NOS protein protein.     23   9.7  
AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.      23   9.7  

>AY081778-1|AAL91655.1|  507|Anopheles gambiae cytochrome P450
           protein.
          Length = 507

 Score = 25.8 bits (54), Expect = 1.4
 Identities = 13/61 (21%), Positives = 29/61 (47%)
 Frame = +2

Query: 446 KLLALKAQLVTEDAGPQKFTLKTPKGTRDYNPQQMTIRNNVLDKIITVFRRHGAECIDTP 625
           K LA +  +   D G ++F L+  +GT +Y       R++ ++ ++ +      +  D P
Sbjct: 230 KGLAKRIGMKLTDEGVERFFLQVVRGTVEYREMNNVQRSDFMNLLLQIKNTGSLDGGDVP 289

Query: 626 V 628
           +
Sbjct: 290 I 290


>DQ004401-1|AAY21240.1|  153|Anopheles gambiae lysozyme c-7 protein.
          Length = 153

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 451 VGFKGSTCNRRC 486
           VG+KG  CN +C
Sbjct: 93  VGYKGGKCNMKC 104


>AY873992-1|AAW71999.1|  259|Anopheles gambiae nanos protein.
          Length = 259

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 58  CSLVTCIFCFN 26
           C L  C+FCFN
Sbjct: 151 CELDHCVFCFN 161


>AY583530-1|AAS93544.1|  260|Anopheles gambiae NOS protein protein.
          Length = 260

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 58  CSLVTCIFCFN 26
           C L  C+FCFN
Sbjct: 152 CELDHCVFCFN 162


>AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.
          Length = 565

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = -1

Query: 722 LMKEFPHLGLSNHIL---ILNPHHTSQ*AHPLAQKQVYQYTQL 603
           L+ ++  LG  +  L   +LNPH     AH LA    + +T++
Sbjct: 332 LITDYHELGSLHDYLQKRVLNPHMLKTLAHSLASGVAHLHTEI 374


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 740,624
Number of Sequences: 2352
Number of extensions: 14377
Number of successful extensions: 39
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 39
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)