SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_F_M21
         (370 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    23   1.3  
EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive pep...    23   1.3  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    22   2.3  
AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    22   2.3  

>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 22.6 bits (46), Expect = 1.3
 Identities = 8/36 (22%), Positives = 18/36 (50%)
 Frame = -3

Query: 179 YYSSHESTVDITAVLPSGEAFNLIWDCSTNSSFEIS 72
           +YS++     +T V  + +    +W+ S   SF ++
Sbjct: 131 FYSAYLVADKVTVVSKNNDDEQYVWESSAGGSFTVT 166


>EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive
           peptide receptor 1 protein.
          Length = 374

 Score = 22.6 bits (46), Expect = 1.3
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +3

Query: 225 NVFISCWSGYI 257
           +VFI CWS YI
Sbjct: 258 SVFILCWSPYI 268


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 21.8 bits (44), Expect = 2.3
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 228 VFISCWSGYI 257
           VF+ CWS YI
Sbjct: 294 VFVLCWSPYI 303


>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 2.3
 Identities = 13/43 (30%), Positives = 23/43 (53%)
 Frame = +2

Query: 119 KLRLTEVLL*CLQYFHETNSSIAFIWAVLNVDTIMECIYLVLE 247
           ++++ +  L CL+     N  +  I +V  V+ + E IY VLE
Sbjct: 305 EMKMDKTELGCLRAIILYNPDVRGIKSVQEVEMLREKIYGVLE 347


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 61,980
Number of Sequences: 336
Number of extensions: 1156
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  7616520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -