SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_F_K05
         (464 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     21   4.9  
EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    21   6.5  

>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = +2

Query: 176 QDYSVWKTNHSSRVDYNKGAVKSIIDENEKHK-YGVS 283
           +DYS+   NHS     N   +K +  +  K++  GVS
Sbjct: 481 KDYSLPMVNHSKSSRINIERMKQVYQQLNKYRGNGVS 517


>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 293 HPETDDGEDP 322
           HPE DDG  P
Sbjct: 123 HPEEDDGGQP 132


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,245
Number of Sequences: 438
Number of extensions: 2382
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12436029
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -