BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_F_K05
(464 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 4.9
EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 6.5
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 21.4 bits (43), Expect = 4.9
Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
Frame = +2
Query: 176 QDYSVWKTNHSSRVDYNKGAVKSIIDENEKHK-YGVS 283
+DYS+ NHS N +K + + K++ GVS
Sbjct: 481 KDYSLPMVNHSKSSRINIERMKQVYQQLNKYRGNGVS 517
>EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle
protein protein.
Length = 138
Score = 21.0 bits (42), Expect = 6.5
Identities = 7/10 (70%), Positives = 7/10 (70%)
Frame = +2
Query: 293 HPETDDGEDP 322
HPE DDG P
Sbjct: 123 HPEEDDGGQP 132
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,245
Number of Sequences: 438
Number of extensions: 2382
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12436029
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -