Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_F_J18
         (590 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    21   6.8  
AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.              21   9.0  
AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta...    21   9.0  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 10/36 (27%), Positives = 14/36 (38%)
 Frame = -2

Query: 127 FSSRDGRRESGDICEARTDQNSDIXENVXTWSAVGT 20
           F+     R+  D+C  +TD N        T    GT
Sbjct: 595 FTDLSNERKYEDVCVLKTDTNQSCPSPPVTTKRDGT 630


>AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.
          Length = 145

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = +1

Query: 37  KXXHFLLYHCFD 72
           K  H  L+HC+D
Sbjct: 100 KERHITLHHCYD 111


>AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta
           protein precursor protein.
          Length = 145

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = +1

Query: 37  KXXHFLLYHCFD 72
           K  H  L+HC+D
Sbjct: 100 KERHITLHHCYD 111


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 117,393
Number of Sequences: 438
Number of extensions: 2047
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17237673
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)