BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_F_G09
(829 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF056617-1|AAF00004.1| 606|Homo sapiens BWSCR2 associated zinc-... 33 0.95
>AF056617-1|AAF00004.1| 606|Homo sapiens BWSCR2 associated
zinc-finger protein BAZ1 protein.
Length = 606
Score = 33.5 bits (73), Expect = 0.95
Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
Frame = +2
Query: 275 HCYPRHHTFDSHNHIDMDCQETHSLIQHIYL*QGIRQEAFRLRHSKDNFNNKFMFH-HLD 451
H + R HT + I+ D + + + HI+ I ++ F+ +FN + H H
Sbjct: 319 HNHQRVHTEEKFYKIECDKDLSRNSLLHIHQRLHIGEKPFKCNQCGKSFNRSSVLHVHQR 378
Query: 452 LHTSDRRYK 478
+HT ++ YK
Sbjct: 379 VHTGEKPYK 387
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,484,830
Number of Sequences: 237096
Number of extensions: 2020378
Number of successful extensions: 3256
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3211
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3254
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10370898348
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -