SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_F_A17
         (848 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyce...    28   1.9  
SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy...    26   7.8  

>SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 469

 Score = 27.9 bits (59), Expect = 1.9
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 9/70 (12%)
 Frame = +1

Query: 208 DFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKVPN------AEDKLKVEKLIDA- 366
           DF  EN+   + +L + +  ++  KDG + +D+    + N      A +K K E   DA 
Sbjct: 84  DFMDENKENGRISLGLSVIVRVTIKDGAYHEDIGYGSIDNCRGKASAFEKCKKEGTTDAL 143

Query: 367 --CLANKGNS 390
              L N GNS
Sbjct: 144 KRALRNFGNS 153


>SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 4924

 Score = 25.8 bits (54), Expect = 7.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +3

Query: 645  ENQNLIFFCVHH 680
            EN+N + FC+HH
Sbjct: 1439 ENKNYVLFCIHH 1450


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,131,044
Number of Sequences: 5004
Number of extensions: 60232
Number of successful extensions: 130
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 130
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 420459900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -