SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P16_pT_P23
         (494 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     24   0.87 
AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax pr...    21   6.1  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    21   6.1  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    21   6.1  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    21   6.1  

>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 23.8 bits (49), Expect = 0.87
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +2

Query: 368 EEALDRYFPYGVHGDGDTRSAEPGCRGFGR 457
           E+  D++  + +H DGD +       GFGR
Sbjct: 225 EDGTDKFMSH-IHNDGDNKPDTILVNGFGR 253


>AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax
           protein.
          Length = 314

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 11/25 (44%), Positives = 11/25 (44%)
 Frame = +3

Query: 393 PTACTVTVTHGLRSPAAVGSDDAPS 467
           P ACT     G  S   VG D A S
Sbjct: 141 PAACTPDSRVGYGSVGLVGGDPASS 165


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 339 CDGRHVPSAGAC 304
           C G  +PSAG C
Sbjct: 101 CQGCEMPSAGLC 112


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 339 CDGRHVPSAGAC 304
           C G  +PSAG C
Sbjct: 49  CQGCEMPSAGLC 60


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 339 CDGRHVPSAGAC 304
           C G  +PSAG C
Sbjct: 232 CQGCEMPSAGLC 243


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,457
Number of Sequences: 336
Number of extensions: 2171
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11630247
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -