BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P16_pT_G17
(680 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
07_02_0017 + 11816603-11816677,11816869-11817026,11817121-11817217 32 0.37
>07_02_0017 + 11816603-11816677,11816869-11817026,11817121-11817217
Length = 109
Score = 32.3 bits (70), Expect = 0.37
Identities = 22/62 (35%), Positives = 32/62 (51%)
Frame = +1
Query: 139 WSSLKINILFLSFCVTKDNLISLIKDFFSSELTIFHSMNLKISLNTNCNFLIFYFTARIF 318
W LKI L L+FC T ++SL FFSS+ I + L +++ T L+ F A
Sbjct: 29 WFVLKITFLLLAFCFTA--MLSLA--FFSSDFMIIAHVLLLVTIGTVLFVLLNRFLAETG 84
Query: 319 LI 324
L+
Sbjct: 85 LV 86
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,298,628
Number of Sequences: 37544
Number of extensions: 165444
Number of successful extensions: 212
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 212
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1721314888
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -