BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P16_pT_F21
(621 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q248A3 Cluster: Cyclic nucleotide-binding domain contai... 33 4.2
>UniRef50_Q248A3 Cluster: Cyclic nucleotide-binding domain
containing protein; n=1; Tetrahymena thermophila
SB210|Rep: Cyclic nucleotide-binding domain containing
protein - Tetrahymena thermophila SB210
Length = 959
Score = 33.5 bits (73), Expect = 4.2
Identities = 21/57 (36%), Positives = 31/57 (54%)
Frame = +2
Query: 134 ENSFILIQQIDVSAEILDN*RTNTFGSV*YRSRLLGTLDFIEIHSYVV*ISNIGRTK 304
ENS+ Q + I +N +TN F +V SR GTL I+I+ Y++ I N T+
Sbjct: 392 ENSYFDQQNQQLEQFIFENQKTNRFSTVTCDSREGGTLIRIKINDYLLRILNYSETR 448
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 523,937,046
Number of Sequences: 1657284
Number of extensions: 9726040
Number of successful extensions: 20203
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19710
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20201
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 45221970467
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -