SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P16_pT_F16
         (669 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1144 + 31222556-31222633,31223238-31227665,31227724-312277...    29   4.4  

>04_04_1144 + 31222556-31222633,31223238-31227665,31227724-31227789,
            31227790-31228014,31228097-31228255,31228393-31228551,
            31228855-31229013,31229371-31229490,31229604-31229825
          Length = 1871

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +3

Query: 150  GINDLYFSNIFTQRAMQDELN*RTRSTASWKRGAGCFRLRAHEQKLSKATNIYS 311
            GIN+     + T+ AM DEL  +  ST + K  A   +L  HE+ +S  T +++
Sbjct: 1291 GINEALKGELDTKVAMFDELQEQFSSTHAEKEEA-AEKLAVHERTISHLTEVHT 1343


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,041,752
Number of Sequences: 37544
Number of extensions: 203004
Number of successful extensions: 303
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 302
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 303
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1691314196
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -