Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P16_pT_D12
         (656 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom...    28   1.4  

>SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 986

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 4/68 (5%)
 Frame = -1

Query: 569 TTRGAAVTSHRTL*EHTAIPLRLSY*CI*C--IMKDDI--FYKASQLISSI*TDIAVEFV 402
           T RGAA++      EHT +P++ S   +    I+ ++I   Y+ + L +    D A +  
Sbjct: 394 TVRGAAISVLSAFEEHTTLPIQQSLREMSATYILNNEINWIYQEALLYACCSVDAASDDT 453

Query: 401 FDDVSEPV 378
           +DD  +P+
Sbjct: 454 YDDYLDPI 461


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,063,777
Number of Sequences: 5004
Number of extensions: 34099
Number of successful extensions: 57
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 57
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 297805304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)