BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P16_F_P20
(437 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 2.2
>AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein
protein.
Length = 370
Score = 22.2 bits (45), Expect = 2.2
Identities = 11/35 (31%), Positives = 15/35 (42%)
Frame = +3
Query: 21 CKLRFQHVLQIVHPLCSVGGRGFRQPQPQA*ASAD 125
C+ RF+ +VH C R P P A+ D
Sbjct: 252 CRGRFRRRHHLVHHKCGGEEEAERAPAPAVRAAGD 286
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,087
Number of Sequences: 336
Number of extensions: 557
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 9775509
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
- SilkBase 1999-2023 -