BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P16_F_J17
(781 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 2.1
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 6.3
DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 8.4
>AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor
candidate 9 protein.
Length = 408
Score = 23.4 bits (48), Expect = 2.1
Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 5/55 (9%)
Frame = -2
Query: 732 CWLIN-KLSS*ICNSQWKNFRFLFFQC----YLNITPSLPNSLTFMNIKIATLSL 583
C+L++ KLS I S NF F+ FQ YL+ +L F+++ + L L
Sbjct: 278 CFLLDEKLSYIILTSFLNNFYFIIFQVFESFYLHKATTLETVYYFISLGLLILRL 332
>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein
protein.
Length = 1156
Score = 21.8 bits (44), Expect = 6.3
Identities = 7/8 (87%), Positives = 8/8 (100%)
Frame = +3
Query: 255 KGTAIPPP 278
KGTA+PPP
Sbjct: 1107 KGTAVPPP 1114
>DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired
protein.
Length = 311
Score = 21.4 bits (43), Expect = 8.4
Identities = 6/11 (54%), Positives = 10/11 (90%)
Frame = +2
Query: 35 CFLKMPKYYCD 67
CF+K+P++Y D
Sbjct: 140 CFVKVPRHYDD 150
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 161,205
Number of Sequences: 336
Number of extensions: 3381
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21065107
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -