SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P16_F_G17
         (747 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    24   1.7  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    24   1.7  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     23   2.3  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   3.0  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   4.0  

>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -2

Query: 368 SRPNTGRYSCSKV 330
           S+ NTG YSC KV
Sbjct: 221 SKTNTGEYSCLKV 233


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -2

Query: 368 SRPNTGRYSCSKV 330
           S+ NTG YSC KV
Sbjct: 221 SKTNTGEYSCLKV 233


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 13/51 (25%), Positives = 22/51 (43%)
 Frame = +3

Query: 555 PSIRELWFHEAPLVPLLGREDQGHRLRRFHRRPQERSGECRHTAARMRPQS 707
           P++ EL F    L+P +    +   L R  R  + ++        +M PQS
Sbjct: 211 PTLEELGFDTEGLLPPVWVGGESEALARLERHLERKAWVASFGRPKMTPQS 261


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 23.0 bits (47), Expect = 3.0
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)
 Frame = +1

Query: 547 NHHLVFVNSGFTKPR-SYRYWDAK--TRGIDFDGFI 645
           NHH +  +SGF   R   RY+  +     +DFD F+
Sbjct: 285 NHHAILGHSGFLCERHQKRYFFGRDSVDHVDFDEFL 320


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = +2

Query: 284 YCPSFVRWKN 313
           YCP +++W N
Sbjct: 473 YCPRYIKWTN 482


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 225,071
Number of Sequences: 438
Number of extensions: 5253
Number of successful extensions: 10
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23388480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -