Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P16_F_F23
         (735 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   6.9  
DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    21   9.1  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    21   9.1  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    21   9.1  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    21   9.1  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   9.1  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +3

Query: 357 DRRRQTLADTSYVPQQENEVYYP 425
           D   QT++ T+ V Q+E E Y P
Sbjct: 338 DLTTQTVSTTADVLQEEEEEYSP 360


>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 727 PPHPKNIGKNADV 689
           PPHP  + K  DV
Sbjct: 452 PPHPIRVAKTIDV 464


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 727 PPHPKNIGKNADV 689
           PPHP  + K  DV
Sbjct: 438 PPHPIRVAKTIDV 450


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 727 PPHPKNIGKNADV 689
           PPHP  + K  DV
Sbjct: 472 PPHPIRVAKTIDV 484


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 727 PPHPKNIGKNADV 689
           PPHP  + K  DV
Sbjct: 421 PPHPIRVAKTIDV 433


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 2/47 (4%)
 Frame = +3

Query: 357  DRRRQTLADTSYVPQQENEV--YYPQQPENPIFSPTQATELADPTEK 491
            DR R+TL      PQQ+ +      QQ +     P      A PT+K
Sbjct: 1437 DRDRKTLTSAPQQPQQQQQQQQQQQQQQQQLNHYPDLHNLYAVPTDK 1483


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 195,543
Number of Sequences: 438
Number of extensions: 4681
Number of successful extensions: 13
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22901220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)