SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P16_F_B06
         (773 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0202 - 14202996-14203241,14203630-14203823,14203947-142045...    29   5.4  

>08_02_0202 -
           14202996-14203241,14203630-14203823,14203947-14204559,
           14205422-14205535
          Length = 388

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = -3

Query: 192 LDMHTRNVFSFHFFLLPIFGKSYVTKRLI-LRLNYSLSSRKKDCLFG 55
           ++M   NV   H    P+  +S  T RL  ++  YSLSS+ +DC  G
Sbjct: 210 MEMPLENVALSHAHARPLQMQSQPTDRLTQVQRGYSLSSKDQDCRVG 256


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,911,640
Number of Sequences: 37544
Number of extensions: 275749
Number of successful extensions: 476
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 476
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2068401984
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -