Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P15_pT_P22
         (406 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY524130-1|AAS17758.1|  211|Anopheles gambiae superoxide dismuta...    25   1.4  
AY176049-1|AAO19580.1|  515|Anopheles gambiae cytochrome P450 CY...    23   5.6  

>AY524130-1|AAS17758.1|  211|Anopheles gambiae superoxide dismutase
           2 protein.
          Length = 211

 Score = 24.6 bits (51), Expect = 1.4
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -1

Query: 349 RVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCT 239
           +VLIALS++L   + K      +V + G +G  G  T
Sbjct: 2   KVLIALSTVLCVVLAKDQPRKAIVYLQGTSGVSGNVT 38


>AY176049-1|AAO19580.1|  515|Anopheles gambiae cytochrome P450
           CYP12F3 protein.
          Length = 515

 Score = 22.6 bits (46), Expect = 5.6
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +3

Query: 372 EKNYHRPAEFI 404
           EK +HRP EFI
Sbjct: 419 EKYFHRPTEFI 429


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 417,794
Number of Sequences: 2352
Number of extensions: 7682
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 32494788
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)