SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P15_pT_N11
         (573 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid p...    22   5.0  
AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatas...    22   5.0  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    22   5.0  
AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    21   8.7  

>DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid
           phosphatase protein.
          Length = 373

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = +2

Query: 227 FYIFHFIIAAESY 265
           +YI+H ++A +SY
Sbjct: 175 YYIYHTLVAEQSY 187


>AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatase
           precursor protein.
          Length = 388

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = +2

Query: 227 FYIFHFIIAAESY 265
           +YI+H ++A +SY
Sbjct: 190 YYIYHTLVAEQSY 202


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = +2

Query: 227 FYIFHFIIAAESY 265
           +YI+H ++A +SY
Sbjct: 78  YYIYHTLVAEQSY 90


>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 10/31 (32%), Positives = 14/31 (45%)
 Frame = -1

Query: 558 YFXNKPMNLLIFSKYVIKSSNSLYTL*QITF 466
           Y  +     L+FSKY  K  N   T+  + F
Sbjct: 361 YVLSDNFQQLLFSKYDAKKRNFFITMFDLDF 391


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,421
Number of Sequences: 438
Number of extensions: 2481
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16504155
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -