BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P15_pT_N11
(573 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 5.0
AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 5.0
AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 5.0
AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.7
>DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid
phosphatase protein.
Length = 373
Score = 21.8 bits (44), Expect = 5.0
Identities = 6/13 (46%), Positives = 11/13 (84%)
Frame = +2
Query: 227 FYIFHFIIAAESY 265
+YI+H ++A +SY
Sbjct: 175 YYIYHTLVAEQSY 187
>AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase
precursor protein.
Length = 388
Score = 21.8 bits (44), Expect = 5.0
Identities = 6/13 (46%), Positives = 11/13 (84%)
Frame = +2
Query: 227 FYIFHFIIAAESY 265
+YI+H ++A +SY
Sbjct: 190 YYIYHTLVAEQSY 202
>AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase
precursor protein.
Length = 156
Score = 21.8 bits (44), Expect = 5.0
Identities = 6/13 (46%), Positives = 11/13 (84%)
Frame = +2
Query: 227 FYIFHFIIAAESY 265
+YI+H ++A +SY
Sbjct: 78 YYIYHTLVAEQSY 90
>AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein
protein.
Length = 411
Score = 21.0 bits (42), Expect = 8.7
Identities = 10/31 (32%), Positives = 14/31 (45%)
Frame = -1
Query: 558 YFXNKPMNLLIFSKYVIKSSNSLYTL*QITF 466
Y + L+FSKY K N T+ + F
Sbjct: 361 YVLSDNFQQLLFSKYDAKKRNFFITMFDLDF 391
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,421
Number of Sequences: 438
Number of extensions: 2481
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16504155
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -