BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P15_pT_M21
(370 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z81124-6|CAB03375.1| 335|Caenorhabditis elegans Hypothetical pr... 26 7.3
>Z81124-6|CAB03375.1| 335|Caenorhabditis elegans Hypothetical
protein T21B4.8 protein.
Length = 335
Score = 26.2 bits (55), Expect = 7.3
Identities = 11/30 (36%), Positives = 20/30 (66%)
Frame = +1
Query: 103 NKCPAIMLAVNRTAKVPGRIIFLMVSIITI 192
N+ +I+L + KVP R++F+ V++I I
Sbjct: 126 NRSSSIILNRLKIDKVPSRVVFICVNVIGI 155
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,672,906
Number of Sequences: 27780
Number of extensions: 85925
Number of successful extensions: 134
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 134
length of database: 12,740,198
effective HSP length: 73
effective length of database: 10,712,258
effective search space used: 524900642
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -