BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P15_pT_D05
(339 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U25801-1|AAB03813.1| 167|Homo sapiens Tax1 binding protein prot... 28 6.4
>U25801-1|AAB03813.1| 167|Homo sapiens Tax1 binding protein
protein.
Length = 167
Score = 28.3 bits (60), Expect = 6.4
Identities = 18/68 (26%), Positives = 32/68 (47%)
Frame = +3
Query: 69 IKCNKNMVMRMSMRSMQPENMQSTQSTPGVRCTQQRPEQYMQQLQGTCSSPAEAWLTRKP 248
IK N+ + M+ + PE+ + + PG R + P+ + + +GT S EA R
Sbjct: 74 IKEVANVCNQSLMKLVTPEDDELDELRPGQRQAEPTPDDALPKQEGTASGCTEAHDFRDI 133
Query: 249 GEQRRSSI 272
R+S+
Sbjct: 134 PPMMRNSL 141
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,435,426
Number of Sequences: 237096
Number of extensions: 408499
Number of successful extensions: 1566
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1529
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1566
length of database: 76,859,062
effective HSP length: 80
effective length of database: 57,891,382
effective search space used: 1852524224
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -