SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P15_F_D06
         (397 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_28159| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.6  

>SB_28159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 491

 Score = 26.2 bits (55), Expect = 9.6
 Identities = 12/46 (26%), Positives = 24/46 (52%)
 Frame = +2

Query: 101 EEERRQIGQNKEEPCRMSSSRFDAQGSCTPWSSLTKRRLRNLSRVY 238
           EEE+ ++     EP   S+S+ + +    PW  +T  +L+   R++
Sbjct: 100 EEEKPEVS----EPATESASQQEKKNGIVPWMRVTTNKLKATQRLF 141


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,257,601
Number of Sequences: 59808
Number of extensions: 140056
Number of successful extensions: 348
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 329
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 348
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 690807992
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -