BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P14_pT_N16
(383 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 3.8
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 22 6.7
>AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic
acetylcholine receptor subunitalpha 3 protein.
Length = 710
Score = 23.0 bits (47), Expect = 3.8
Identities = 10/34 (29%), Positives = 21/34 (61%)
Frame = +1
Query: 265 YDSFFVFIYYSDEI*DTKYVQCTLNETKFFNLVK 366
YD F V + + DE+ +T V+ ++ ++F+ V+
Sbjct: 171 YDGFQVDLRHIDEMNETNVVEVGVDLSEFYTSVE 204
>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative
5-oxoprolinase protein.
Length = 1344
Score = 22.2 bits (45), Expect = 6.7
Identities = 9/11 (81%), Positives = 9/11 (81%)
Frame = +1
Query: 193 QHRCSI*RQLG 225
QH CSI RQLG
Sbjct: 509 QHACSIARQLG 519
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 338,819
Number of Sequences: 2352
Number of extensions: 5333
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 29501847
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -