Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P14_pT_L04
         (592 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0112 + 16781770-16782020,16782032-16782764                       30   1.6  

>06_03_0112 + 16781770-16782020,16782032-16782764
          Length = 327

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 20/50 (40%), Positives = 25/50 (50%)
 Frame = +2

Query: 8   STQAAIPYISIPPSRTFKIPLFYMYYVLTLNRYYEPKLPIANTCDDVIQR 157
           ST AA P     P+ TF  P  Y Y+ +  N Y+ P L   NT  + IQR
Sbjct: 210 STSAAPPPHGYDPN-TFFHPQ-YAYFRIQPNEYFNPVLRAINTLSENIQR 257


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,289,887
Number of Sequences: 37544
Number of extensions: 264531
Number of successful extensions: 509
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 504
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 509
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1400060088
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)