SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P14_pT_F05
         (667 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8I1Z0 Cluster: Putative uncharacterized protein PFD019...    36   1.2  

>UniRef50_Q8I1Z0 Cluster: Putative uncharacterized protein PFD0190w;
           n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PFD0190w - Plasmodium falciparum
           (isolate 3D7)
          Length = 1186

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -2

Query: 411 EPLSSFDFNILTLFRLEHGDYKHSNQRSLFHHGDS-DVYYARVIKSLLIEEK 259
           +P+ +F  N+      E+ D+ HS+   ++HH DS D Y  +++K+++ +EK
Sbjct: 558 DPIHTFK-NMFCKSEKENLDFNHSDMFHIYHHNDSMDKYVNKILKNIMNKEK 608


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 527,740,090
Number of Sequences: 1657284
Number of extensions: 9244611
Number of successful extensions: 19446
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17306
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19440
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50826451017
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -