Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P14_pT_C18
         (326 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF273437-1|AAF75796.1| 1125|Homo sapiens actin binding protein a...    28   7.7  

>AF273437-1|AAF75796.1| 1125|Homo sapiens actin binding protein
           anillin protein.
          Length = 1125

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -1

Query: 275 VSITIRMSKVKKY-VPSTPEFEKTIGRYKEFVANLDDPDSEPIRVFDPLSQSMLEE 111
           + IT+ + + K   V S P+ E+ I   +E   ++DD D    +V + L   +LEE
Sbjct: 521 LKITLFLEEDKSLKVTSDPKVEQKIEVIREIEMSVDDDDINSSKVINDLFSDVLEE 576


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,672,471
Number of Sequences: 237096
Number of extensions: 650666
Number of successful extensions: 1495
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1485
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1495
length of database: 76,859,062
effective HSP length: 79
effective length of database: 58,128,478
effective search space used: 1685725862
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)