BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P14_F_H05
(495 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A2DLQ1 Cluster: Putative uncharacterized protein; n=3; ... 32 6.1
>UniRef50_A2DLQ1 Cluster: Putative uncharacterized protein; n=3;
Trichomonas vaginalis G3|Rep: Putative uncharacterized
protein - Trichomonas vaginalis G3
Length = 406
Score = 32.3 bits (70), Expect = 6.1
Identities = 16/44 (36%), Positives = 23/44 (52%)
Frame = +3
Query: 132 VKGSKYCTD*REGTGITPSQDPIFEMTVSYTEKDTYLLVLFHFI 263
+KG Y R GI PS P+F+ V+Y T +L+ HF+
Sbjct: 250 IKGHLYVIHER---GIDPSTTPVFKQFVTYHRYKTVILIYIHFV 290
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 330,556,739
Number of Sequences: 1657284
Number of extensions: 5892557
Number of successful extensions: 15299
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13828
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15258
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 28855457139
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -