Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P14_F_B03
         (359 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A4XHP8 Cluster: PBS lyase HEAT domain protein repeat-co...    33   2.0  
UniRef50_Q9VW32 Cluster: CG8756-PA, isoform A; n=26; Endopterygo...    31   8.0  

>UniRef50_A4XHP8 Cluster: PBS lyase HEAT domain protein
           repeat-containing protein; n=1; Caldicellulosiruptor
           saccharolyticus DSM 8903|Rep: PBS lyase HEAT domain
           protein repeat-containing protein - Caldicellulosiruptor
           saccharolyticus (strain ATCC 43494 / DSM 8903)
          Length = 492

 Score = 32.7 bits (71), Expect = 2.0
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 81  HDLEPHVLY*LILIWCSSCSKYIIVGNVTKAI--LSNEYVFE*VQSVPGHNPARSLS-TY 251
           H  EP V+  LI ++ S+ +K +I  ++ KA+  +  EY  E +  +  H+ AR  +  Y
Sbjct: 28  HFKEPVVIDKLIELFISTNNK-MIEEHIAKALKQIGGEYTVEKLLRLLDHDEARVRTFAY 86

Query: 252 PIVCNIGSH 278
            ++C IGSH
Sbjct: 87  EVLCEIGSH 95


>UniRef50_Q9VW32 Cluster: CG8756-PA, isoform A; n=26;
           Endopterygota|Rep: CG8756-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 570

 Score = 30.7 bits (66), Expect = 8.0
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 31  NYPWLNDPTGDG 66
           NYPW+ DPTGDG
Sbjct: 556 NYPWILDPTGDG 567


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 311,239,017
Number of Sequences: 1657284
Number of extensions: 5137707
Number of successful extensions: 9832
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9691
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9832
length of database: 575,637,011
effective HSP length: 90
effective length of database: 426,481,451
effective search space used: 12367962079
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)