SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_pT_P22
         (562 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    21   8.5  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    21   8.5  

>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 21.0 bits (42), Expect = 8.5
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 474 CQWLYKSLILH 506
           C++LYK L LH
Sbjct: 328 CEYLYKQLELH 338


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 21.0 bits (42), Expect = 8.5
 Identities = 10/40 (25%), Positives = 21/40 (52%)
 Frame = -3

Query: 281 FAFSGKKISKNKV*SITISYVSGMLLRKSLNFVINVKVLE 162
           F  +GKKIS+ +   +    + G    + +N+++  K +E
Sbjct: 278 FVKTGKKISELEKEMLNGQKLQGPFTAEEVNYMLKAKNME 317


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,358
Number of Sequences: 438
Number of extensions: 3173
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16195212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -