SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_pT_F23
         (406 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q07818 Cluster: Apoptosis regulator Bcl-2 homolog precu...    32   5.0  

>UniRef50_Q07818 Cluster: Apoptosis regulator Bcl-2 homolog
           precursor; n=3; African swine fever virus|Rep: Apoptosis
           regulator Bcl-2 homolog precursor - African swine fever
           virus (strain E-70 / isolate MS44) (ASFV)
          Length = 179

 Score = 31.9 bits (69), Expect = 5.0
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 10/76 (13%)
 Frame = -1

Query: 403 HTIIXKYI*SYIMHYINNVSFHNKFP---NVKKII*H-----*HQLTLDIYKTQCQQSRV 248
           H II + +  YI +YIN++S H   P    +KKI+ +       Q+T+    T  Q+ + 
Sbjct: 9   HNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKT 68

Query: 247 YNSDSVLEVF--YLNW 206
             +  V E+F   +NW
Sbjct: 69  QFTGVVTELFRDLINW 84


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 306,223,609
Number of Sequences: 1657284
Number of extensions: 4303922
Number of successful extensions: 7544
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7441
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7544
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 17773009086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -