Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P13_pT_C01
(817 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 25 0.63
DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 25 0.63
AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 25 1.1
AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.4
U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 23 4.5
DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 4.5
DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 4.5
DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 4.5
DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 4.5
DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 4.5
DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 4.5
DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 4.5
DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 4.5
DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 4.5
DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 4.5
DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 4.5
DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 4.5
DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 4.5
AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 4.5
AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 4.5
AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 4.5
AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 4.5
AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 4.5
AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 4.5
AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 4.5
AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 4.5
AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 4.5
EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.9
DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 5.9
DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 5.9
DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 5.9
DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 5.9
DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 5.9
DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 5.9
DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 5.9
AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 5.9
AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.9
AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.9
AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 5.9
AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.9
AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 5.9
DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 7.8
DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 7.8
AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 7.8
AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 7.8
>DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein.
Length = 132
Score = 25.4 bits (53), Expect = 0.63
Identities = 14/43 (32%), Positives = 20/43 (46%)
Frame = -3
Query: 143 IRKYLLEDNLTDAEYAQRKRIGXKRANDVRLMLRVDCVWKSLG 15
I E+N D + A + G ND +L VDC+ K +G
Sbjct: 29 IESVCAEENGIDLKKADDVKKGIFDKNDEKLACYVDCMLKKVG 71
>DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein.
Length = 552
Score = 25.4 bits (53), Expect = 0.63
Identities = 9/18 (50%), Positives = 10/18 (55%)
Frame = -3
Query: 743 WLDKTCLFGANAIVVSPG 690
WL CLFG I + PG
Sbjct: 7 WLLSICLFGLQEIAIQPG 24
>AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein.
Length = 400
Score = 24.6 bits (51), Expect = 1.1
Identities = 19/75 (25%), Positives = 32/75 (42%)
Frame = -2
Query: 585 ERQKRRSQDLRFDVCQQKHDHFRADSEIRSRVCRQNAKSQSSLGRLCGIHGEPHAVPPVN 406
ER RR + Q+ + + R E R R+ ++ + GR H + P +
Sbjct: 280 ERTSRRRYSRSREREQKSYKNEREYREYRE-TSRERSRDRRGRGR-----SREHRIIPSH 333
Query: 405 LDPAVPACLYCGHFP 361
+PA +Y G+FP
Sbjct: 334 YIEQIPAPVYYGNFP 348
>AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein.
Length = 996
Score = 23.0 bits (47), Expect = 3.4
Identities = 10/38 (26%), Positives = 18/38 (47%)
Frame = -2
Query: 570 RSQDLRFDVCQQKHDHFRADSEIRSRVCRQNAKSQSSL 457
+S D F C+ +FRA+ + + C Q + +L
Sbjct: 287 KSSDYGFTECRCDPGYFRAEKDPKKMPCTQPPSAPQNL 324
>U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor
protein.
Length = 95
Score = 22.6 bits (46), Expect = 4.5
Identities = 8/19 (42%), Positives = 12/19 (63%)
Frame = +2
Query: 521 K*SCFC*QTSKRRSWERRF 577
K C C +TS + W++RF
Sbjct: 76 KVGCICRKTSFKDLWDKRF 94
>DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 125 VPVPIYCGNFP 135
>DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 121 VPVPIYCGNFP 131
>DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 125 VPVPIYCGNFP 135
>DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 125 VPVPIYCGNFP 135
>DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 125 VPVPIYCGNFP 135
>DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 125 VPVPIYCGNFP 135
>DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex
determiner protein.
Length = 180
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 120 VPVPIYCGNFP 130
>DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex
determiner protein.
Length = 180
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 120 VPVPIYCGNFP 130
>DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex
determiner protein.
Length = 182
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex
determiner protein.
Length = 183
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 123 VPVPIYCGNFP 133
>DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex
determiner protein.
Length = 178
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 118 VPVPIYCGNFP 128
>DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex
determiner protein.
Length = 186
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 126 VPVPIYCGNFP 136
>DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex
determiner protein.
Length = 191
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 131 VPVPIYCGNFP 141
>AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex
determiner protein.
Length = 400
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 340 VPVPIYCGNFP 350
>AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex
determiner protein.
Length = 397
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 337 VPVPIYCGNFP 347
>AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex
determiner protein.
Length = 406
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 346 VPVPIYCGNFP 356
>AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex
determiner protein.
Length = 408
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 348 VPVPIYCGNFP 358
>AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex
determiner protein.
Length = 419
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 359 VPVPIYCGNFP 369
>AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex
determiner protein.
Length = 426
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 366 VPVPIYCGNFP 376
>AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex
determiner protein.
Length = 418
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 358 VPVPIYCGNFP 368
>AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex
determiner protein.
Length = 425
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 365 VPVPIYCGNFP 375
>AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex
determiner protein.
Length = 428
Score = 22.6 bits (46), Expect = 4.5
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 368 VPVPIYCGNFP 378
>EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase
protein.
Length = 620
Score = 22.2 bits (45), Expect = 5.9
Identities = 8/21 (38%), Positives = 13/21 (61%)
Frame = -1
Query: 526 SLSGRFRNTLSSLPPKCQVPK 464
++ GR NT+ LPP ++ K
Sbjct: 478 AVCGRIENTIQGLPPPYRLNK 498
>DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 22.2 bits (45), Expect = 5.9
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 119 IPVPIYCGNFP 129
>DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 22.2 bits (45), Expect = 5.9
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 119 IPVPIYCGNFP 129
>DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex
determiner protein.
Length = 179
Score = 22.2 bits (45), Expect = 5.9
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 119 IPVPIYCGNFP 129
>DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex
determiner protein.
Length = 182
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 122 VPVPVYCGNFP 132
>DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 126 VPVPVYCGNFP 136
>DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex
determiner protein.
Length = 185
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 126 VPVPVYCGNFP 136
>DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 22.2 bits (45), Expect = 5.9
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPIYCGNFP 131
>AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex
determiner protein.
Length = 396
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 336 VPIPIYCGNFP 346
>AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex
determiner protein.
Length = 407
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 347 VPIPIYCGNFP 357
>AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex
determiner protein.
Length = 407
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 347 VPIPIYCGNFP 357
>AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex
determiner protein.
Length = 396
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 336 VPIPIYCGNFP 346
>AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex
determiner protein.
Length = 407
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
VP +YCG+FP
Sbjct: 348 VPVPVYCGNFP 358
>AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin
precursor protein.
Length = 95
Score = 22.2 bits (45), Expect = 5.9
Identities = 7/16 (43%), Positives = 11/16 (68%)
Frame = +2
Query: 530 CFC*QTSKRRSWERRF 577
C C +TS + W++RF
Sbjct: 79 CICRKTSFKDLWDKRF 94
>DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex
determiner protein.
Length = 181
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 121 IPVPVYCGNFP 131
>AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex
determiner protein.
Length = 414
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 354 IPVPVYCGNFP 364
>AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex
determiner protein.
Length = 414
Score = 21.8 bits (44), Expect = 7.8
Identities = 6/11 (54%), Positives = 9/11 (81%)
Frame = -2
Query: 393 VPACLYCGHFP 361
+P +YCG+FP
Sbjct: 354 IPVPVYCGNFP 364
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,358
Number of Sequences: 438
Number of extensions: 5630
Number of successful extensions: 69
Number of sequences better than 10.0: 64
Number of HSP's better than 10.0 without gapping: 69
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 69
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25974678
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -