Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_pT_B11
         (700 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK222787-1|BAD96507.1|  671|Homo sapiens leucine rich repeat con...    30   6.9  

>AK222787-1|BAD96507.1|  671|Homo sapiens leucine rich repeat
           containing 5 variant protein.
          Length = 671

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 19/70 (27%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +3

Query: 465 YIRFILVFTGRYMFCDYICCTSGFVSK*FLEELTT--LQHFI*RVMFCCTLHHFVHVVC- 635
           Y+   ++ T +++F   +C T+ FV+    E +    ++H I   +F CT H+  +++  
Sbjct: 121 YVVQTVIKTAKFIFI--LCYTANFVNAISFEHVCKPKVEHLIGHEVFECT-HNMAYMLKK 177

Query: 636 ILITYVVILC 665
           +LI+Y+ I+C
Sbjct: 178 LLISYISIIC 187


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,856,826
Number of Sequences: 237096
Number of extensions: 1872157
Number of successful extensions: 3236
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3236
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)