SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_pT_A08
         (340 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    23   1.0  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    21   3.1  
AY078399-1|AAL83702.1|   31|Apis mellifera major royal jelly pro...    21   5.4  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    21   5.4  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    21   5.4  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    21   5.4  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    21   5.4  
DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              20   9.4  

>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 23.0 bits (47), Expect = 1.0
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -3

Query: 200 LYVCVGIGCGGAVFYTLR 147
           L VC+GI C G    T+R
Sbjct: 7   LVVCLGIACQGITSVTVR 24


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 3.1
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +1

Query: 172 PHPIPTHTYRGIKALCFFKLERLSPCILNYLIAL 273
           P+P  T+  R  +   F+    + PCIL   +AL
Sbjct: 199 PYPDITYEIRLRRRPMFYVFNLILPCILINSVAL 232


>AY078399-1|AAL83702.1|   31|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 31

 Score = 20.6 bits (41), Expect = 5.4
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -3

Query: 200 LYVCVGIGCGGAV 162
           +  C+GI C GA+
Sbjct: 7   MVACLGIACQGAI 19


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 20.6 bits (41), Expect = 5.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 277 IRKNCPQTEYCCR 315
           ++K CPQ E C R
Sbjct: 262 LKKLCPQEEACFR 274


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 20.6 bits (41), Expect = 5.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 277 IRKNCPQTEYCCR 315
           ++K CPQ E C R
Sbjct: 177 LKKLCPQEEACFR 189


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 20.6 bits (41), Expect = 5.4
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 277 IRKNCPQTEYCCR 315
           ++K CPQ E C R
Sbjct: 496 LKKLCPQEEACFR 508


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 20.6 bits (41), Expect = 5.4
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -3

Query: 200 LYVCVGIGCGGAV 162
           +  C+GI C GA+
Sbjct: 7   MVACLGIACQGAI 19


>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 19.8 bits (39), Expect = 9.4
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = +1

Query: 310 CRYRYRFN 333
           C Y YRFN
Sbjct: 124 CEYAYRFN 131


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,025
Number of Sequences: 438
Number of extensions: 2474
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7715466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -