SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_F_N10
         (848 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    24   1.7  
L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protei...    22   5.3  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    22   5.3  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 9/36 (25%), Positives = 19/36 (52%)
 Frame = +1

Query: 730 LLNAWVFVXSMPTIVEFSHETASXIFGGKIKYHLLI 837
           ++N W F+  +  ++EF  +  S     + K HL++
Sbjct: 459 VINRWKFIEFIRKVLEFDVKCVSNYTKQQSKIHLIV 494


>L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protein
           protein.
          Length = 74

 Score = 22.2 bits (45), Expect = 5.3
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 489 TG*RTYRCQYC 521
           TG R YRC++C
Sbjct: 33  TGERPYRCEHC 43


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 22.2 bits (45), Expect = 5.3
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 489 TG*RTYRCQYC 521
           TG R YRC++C
Sbjct: 186 TGERPYRCEHC 196


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,807
Number of Sequences: 336
Number of extensions: 3292
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23451794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -