Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_F_N09
         (381 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosacch...    44   8e-06

>SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 312

 Score = 44.0 bits (99), Expect = 8e-06
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +1

Query: 103 PTLASAPHSIANGFKHLLAIAAVTXVEFEXATTIKEFIKDPSKF 234
           PT+ S  HS+ N +K+L+A++  T   FE     K F+ DPS F
Sbjct: 230 PTILSVMHSVVNAYKNLVAVSLATEYTFEGTEQTKAFLADPSAF 273


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.131    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 832,240
Number of Sequences: 5004
Number of extensions: 12028
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 2,362,478
effective HSP length: 65
effective length of database: 2,037,218
effective search space used: 124270298
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)