SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_F_J22
         (577 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q65M86 Cluster: Putative uncharacterized protein; n=2; ...    32   8.4  

>UniRef50_Q65M86 Cluster: Putative uncharacterized protein; n=2;
           Bacillus|Rep: Putative uncharacterized protein -
           Bacillus licheniformis (strain DSM 13 / ATCC 14580)
          Length = 532

 Score = 32.3 bits (70), Expect = 8.4
 Identities = 20/44 (45%), Positives = 24/44 (54%)
 Frame = -1

Query: 295 DLFELPSPWLPEVPSVVLLASVCGLDRLRPSPWTPSWVLSGVFF 164
           +L    SPW+P V S  +LA    +D   P P T S VLSGV F
Sbjct: 489 ELLHEESPWVPLVHSTPILAGSKDIDGYVPHP-TGSEVLSGVEF 531


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 470,037,953
Number of Sequences: 1657284
Number of extensions: 7998345
Number of successful extensions: 18759
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18287
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18756
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 39571085965
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -