SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_F_I04
         (737 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase ...    23   3.4  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    23   3.4  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    23   3.4  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    23   3.4  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    23   3.4  
EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    22   4.5  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    22   5.9  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   7.9  
AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    21   7.9  

>AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase
           protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 215 KATEHVIGCVLC 226


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 529 KATEHVIGCVLC 540


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 789 KATEHVIGCVLC 800


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 789 KATEHVIGCVLC 800


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 762 KATEHVIGCVLC 773


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 762 KATEHVIGCVLC 773


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 789 KATEHVIGCVLC 800


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 60  KITQELLGCVLC 25
           K T+ ++GCVLC
Sbjct: 789 KATEHVIGCVLC 800


>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 415 WNSHSLLSSGQTC 377
           WN H LL++ Q C
Sbjct: 348 WNPHKLLTAPQQC 360


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = -3

Query: 432 FNDHTFGTPILYCLVDKLVESSTNGKYSGNGMHDYK 325
           F  H     I +  V    +S+ NG+   N +H YK
Sbjct: 118 FGAHWMKESISFAKVKLTNKSNGNGQIMLNSLHKYK 153


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -1

Query: 251 YVISANSTVVDNNIPS 204
           YVI  N+ V+  NIPS
Sbjct: 133 YVIRGNTAVLKCNIPS 148


>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/16 (37%), Positives = 12/16 (75%)
 Frame = -1

Query: 638 FLFIIIGVYYFYARLL 591
           F+FI++ ++Y  A L+
Sbjct: 245 FIFIVVSIFYMSAYLI 260


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 174,459
Number of Sequences: 336
Number of extensions: 3982
Number of successful extensions: 16
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19779950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -