Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P13_F_B03
         (759 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    25   1.0  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    22   5.4  
AY739659-1|AAU85298.1|  288|Apis mellifera hyperpolarization-act...    22   5.4  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    22   5.4  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    22   5.4  
AY217747-1|AAP45005.1|  246|Apis mellifera short-chain dehydroge...    22   7.2  

>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +2

Query: 11  MVPRLSLSANGLVYTRKIRSRFGQSC*KSFIITLTTHKLTFPLIV 145
           +VP L+L  N LV    +R R  Q+    FI++L    L   ++V
Sbjct: 195 IVPCLTLFGNVLVILAVVRERALQTVTNYFIVSLAVADLLVAVLV 239


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -1

Query: 417 VGSQCVHGVQAW 382
           +G++ VHG+Q W
Sbjct: 14  LGNESVHGIQKW 25


>AY739659-1|AAU85298.1|  288|Apis mellifera
           hyperpolarization-activated ion channelvariant T
           protein.
          Length = 288

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 735 DLSARFITFHCLA 697
           DLS R+I F+CL+
Sbjct: 116 DLSTRWIAFNCLS 128


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 735 DLSARFITFHCLA 697
           DLS R+I F+CL+
Sbjct: 116 DLSTRWIAFNCLS 128


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 735 DLSARFITFHCLA 697
           DLS R+I F+CL+
Sbjct: 116 DLSTRWIAFNCLS 128


>AY217747-1|AAP45005.1|  246|Apis mellifera short-chain
           dehydrogenase/reductase protein.
          Length = 246

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 9/31 (29%), Positives = 15/31 (48%)
 Frame = +3

Query: 150 AQCSVNAIVILVKVNFLKNVIIEMWTSVNTR 242
           AQC  N  VI +  + ++  +   W   N+R
Sbjct: 180 AQCESNIKVISISPDLVETDMTAQWLKENSR 210


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,713
Number of Sequences: 438
Number of extensions: 4659
Number of successful extensions: 10
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23875740
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)