Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P12_pT_M09
         (629 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q05FP4 Cluster: Putative uncharacterized protein; n=1; ...    32   9.9  

>UniRef50_Q05FP4 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Carsonella ruddii PV|Rep: Putative
           uncharacterized protein - Carsonella ruddii (strain PV)
          Length = 426

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +3

Query: 108 IXYGHCAFFFSNLQSIKGMNFFDIY*MLLNINYFTLYKNIWK---H*HFGIMN*ISLVIY 278
           + +    F  S +++IK +NF     +  N N++ LYKN+ K   H H  I +  +L++ 
Sbjct: 203 VNFNSLIFNISKIKNIKRINFLSSNIIDFNKNFYNLYKNVKKISNHIHLPIQSGSNLILK 262

Query: 279 ELH 287
           +++
Sbjct: 263 KMN 265


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 530,542,503
Number of Sequences: 1657284
Number of extensions: 9235399
Number of successful extensions: 15286
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14947
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15285
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46466611856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)