BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P12_pT_K15
(653 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
10_08_0285 - 16493678-16493750,16493824-16494380,16494657-164947... 28 5.6
>10_08_0285 -
16493678-16493750,16493824-16494380,16494657-16494798,
16495349-16495459,16495593-16496812
Length = 700
Score = 28.3 bits (60), Expect = 5.6
Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
Frame = -3
Query: 582 CSSFIIELSKKCLSYCNIVC--KEYIDKVXXXXXXXXXXXXYGSTHFXFEETPMVLLCHM 409
C S ++ ++ S CNI C Y++ V +T+ E++P +L C
Sbjct: 385 CRSLVVGDGRETTSRCNIFCFSLSYVEDVDRVEPFSIPPVLGEATYSEIEDSPNMLECCR 444
Query: 408 LF 403
+F
Sbjct: 445 MF 446
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,913,698
Number of Sequences: 37544
Number of extensions: 199451
Number of successful extensions: 340
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 333
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 340
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1632177336
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -