SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P12_pT_K13
         (538 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15954-1|AAA67442.1|   53|Apis mellifera abaecin precursor protein.    23   1.5  
AF442147-1|AAL35348.1|   33|Apis mellifera abaecin precursor pro...    23   1.5  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    21   6.0  

>U15954-1|AAA67442.1|   53|Apis mellifera abaecin precursor protein.
          Length = 53

 Score = 23.4 bits (48), Expect = 1.5
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 390 KPFQTFSGQNPF 425
           +PF TF GQ PF
Sbjct: 32  RPFPTFPGQGPF 43


>AF442147-1|AAL35348.1|   33|Apis mellifera abaecin precursor
           protein.
          Length = 33

 Score = 23.4 bits (48), Expect = 1.5
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 390 KPFQTFSGQNPF 425
           +PF TF GQ PF
Sbjct: 18  RPFPTFPGQGPF 29


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +2

Query: 257 SQGLQFFFHRFLNTFYSYLRQRKLASCPPLLLGLHVRTQSFW 382
           +QG    + R  + F S L  + ++    LL GL   T S W
Sbjct: 287 NQGNDVQYERVQDVFDSQLTVKAVSKNGVLLFGLANNTLSCW 328


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,000
Number of Sequences: 438
Number of extensions: 3606
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15213684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -