BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P12_pT_I11
(567 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY060438-1|AAL25477.1| 906|Drosophila melanogaster LD46618p pro... 29 4.4
>AY060438-1|AAL25477.1| 906|Drosophila melanogaster LD46618p protein.
Length = 906
Score = 29.1 bits (62), Expect = 4.4
Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
Frame = +2
Query: 167 RNRQRNDIYPCGYNKPSTTVQKFVSTYFYTKKIA-DTQMPNNKLF*KYFSLNFKIVHTRI 343
+NR I C Y TT+ + ++ + ++I+ T +++L + L +++ R
Sbjct: 831 QNRAMRAITDCPYYVRGTTLHRDLNLHTVEEQISRHTSRYSDRLRRHHSILARRLLPARP 890
Query: 344 TRRLNKEGYLKTL 382
RRL ++G+ KTL
Sbjct: 891 LRRLKRKGFAKTL 903
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,533,131
Number of Sequences: 53049
Number of extensions: 386443
Number of successful extensions: 737
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 724
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 737
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2213979693
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -