Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P12_pT_D22
         (374 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   3.7  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    23   5.0  
AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          23   5.0  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    22   6.5  
AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.    22   8.7  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 161  STGATNGVNRPP 196
            STG++N  NRPP
Sbjct: 1627 STGSSNSCNRPP 1638


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = -3

Query: 369 ELILKRILVLKSRTLNFLNQHSS 301
           E + +R+ +LKS   N  NQ+S+
Sbjct: 288 EFLEQRVNILKSSAQNICNQYSA 310


>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 5.0
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = -2

Query: 214 CCNIWHWGSVDS 179
           CC +W W  ++S
Sbjct: 88  CCRLWRWPDLNS 99


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -2

Query: 79  HCXTVDCCC 53
           H  T DCCC
Sbjct: 125 HADTTDCCC 133


>AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.
          Length = 163

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +3

Query: 102 SMLVQQRLCFLPLFPLS*NRAREPLMESTDPQCHILQHR 218
           SMLV   +   P  PLS ++++ P  ++     H L H+
Sbjct: 38  SMLVTGSMPPSPYAPLSMSKSQTPPQDTVGTAQHQLHHQ 76


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 338,819
Number of Sequences: 2352
Number of extensions: 5828
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 28804305
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)