SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P12_F_P05
         (373 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    23   2.8  
DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor...    23   3.7  
AY705405-1|AAU12514.1|  519|Anopheles gambiae nicotinic acetylch...    22   6.4  

>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 14/56 (25%), Positives = 23/56 (41%)
 Frame = +1

Query: 58  SNHHPNHXQNRKAHSQWYQKAKEXQARIHPWHGSKIFKESKVLQEG*PEASQATRE 225
           S HH +H  +   HSQ    A      + P H   +F  ++  +E    A +  R+
Sbjct: 181 SQHHHHHHHHHPHHSQQQHSASPRCYPMPPEHMYNMFNFNRNGREARNRAEKNRRD 236


>DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor 24
           protein.
          Length = 378

 Score = 23.0 bits (47), Expect = 3.7
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 299 YAFICLYLMFI 267
           + FICLYL FI
Sbjct: 232 FTFICLYLFFI 242


>AY705405-1|AAU12514.1|  519|Anopheles gambiae nicotinic
           acetylcholine receptor subunitbeta 1 protein.
          Length = 519

 Score = 22.2 bits (45), Expect = 6.4
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 64  HHPNHXQNRKAHS 102
           HHPN   NRK +S
Sbjct: 405 HHPNCKMNRKLNS 417


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 278,266
Number of Sequences: 2352
Number of extensions: 4329
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 28374390
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -